missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TMEM55A Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£159.00 - £375.00
Specifications
| Antigen | TMEM55A |
|---|---|
| Dilution | Western Blot 1:200-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18699131
|
Novus Biologicals
NBP2-94829-0.02ml |
0.02 mL |
£159.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18631512
|
Novus Biologicals
NBP2-94829-0.1ml |
0.1 mL |
£375.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
TMEM55A Polyclonal antibody specifically detects TMEM55A in Mouse samples. It is validated for Western BlotSpecifications
| TMEM55A | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cardiovascular Biology, Endocrinology, Signal Transduction | |
| PBS (pH 7.3), 50% glycerol | |
| 55529 | |
| IgG | |
| Affinity purified |
| Western Blot 1:200-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Mouse | |
| DKFZp762O076, EC 3.1.3.78, PtdIns-4,5-P(2) 4-phosphatase type II, PtdIns-4,5-P2 4-Ptase II, transmembrane protein 55A, Type II phosphatidylinositol 4,5-bisphosphate 4-phosphatase | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 130-195 of human TMEM55A (NP_061180.1). VMLISEEQPAQPALPIQPEGTRVVCGHCGNTFLWMELRFNTLAKCPHCKKISSVGSALPRRRCCAY | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title