missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TMEM55A Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94829-0.02ml
This item is not returnable.
View return policy
Description
TMEM55A Polyclonal antibody specifically detects TMEM55A in Mouse samples. It is validated for Western Blot
Specifications
| TMEM55A | |
| Polyclonal | |
| Western Blot 1:200-1:2000 | |
| DKFZp762O076, EC 3.1.3.78, PtdIns-4,5-P(2) 4-phosphatase type II, PtdIns-4,5-P2 4-Ptase II, transmembrane protein 55A, Type II phosphatidylinositol 4,5-bisphosphate 4-phosphatase | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 130-195 of human TMEM55A (NP_061180.1). VMLISEEQPAQPALPIQPEGTRVVCGHCGNTFLWMELRFNTLAKCPHCKKISSVGSALPRRRCCAY | |
| 0.02 mL | |
| Cardiovascular Biology, Endocrinology, Signal Transduction | |
| 55529 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Ser du en mulighed for forbedring?Del en indholdskorrektion