missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TMEM165 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£130.00 - £290.00
Specifications
| Antigen | TMEM165 |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18357452
|
Novus Biologicals
NBP3-15530-20UL |
20 μg |
£130.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18376526
|
Novus Biologicals
NBP3-15530-100UL |
100 μg |
£290.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
TMEM165 Polyclonal antibody specifically detects TMEM165 in Human samples. It is validated for Western BlotSpecifications
| TMEM165 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cell Biology | |
| PBS, 50% glycerol, pH7.3 | |
| 55858 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| transmembrane protein 165 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 172-230 of human TMEM165 (NP_060945.2). IRMLREGLKMSPDEGQEELEEVQAELKKKDEEFQRTKLLNGPGDVETGTSITVPQKKWL | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title