missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TMEM165 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-15530-100UL
This item is not returnable.
View return policy
Description
TMEM165 Polyclonal antibody specifically detects TMEM165 in Human samples. It is validated for Western Blot
Specifications
| TMEM165 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000 | |
| transmembrane protein 165 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 172-230 of human TMEM165 (NP_060945.2). IRMLREGLKMSPDEGQEELEEVQAELKKKDEEFQRTKLLNGPGDVETGTSITVPQKKWL | |
| 100 μg | |
| Cell Biology | |
| 55858 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS, 50% glycerol, pH7.3 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction