missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TM4SF19 Rabbit anti-Human, Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£139.00 - £274.00
Specifications
| Antigen | TM4SF19 |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18393797
|
Novus Biologicals
NBP3-16026-20UL |
20 μg |
£139.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18301337
|
Novus Biologicals
NBP3-16026-100UL |
100 μg |
£274.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
TM4SF19 Polyclonal antibody specifically detects TM4SF19 in Human, Mouse samples. It is validated for Western BlotSpecifications
| TM4SF19 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human, Mouse | |
| Osteoclast maturation-associated gene 4 protein, Tetraspan membrane protein OCTM4, transmembrane 4 L six family member 19, transmembrane 4 L6 family member 19 | |
| A synthetic peptide corresponding to a sequence within amino acids 50-150 of human TM4SF19 (NP_001191827.1). LLGRHAMLGTGLWGGGLMVLTALLSGGLALLGALICFVTSGVALKDGPFCMFDVSSFNQTQAWKYGYPFKDLHSRNYLYDRSLWNSVCLEPSAAVVWHVSL | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| Western Blot 1:500 - 1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS, 50% glycerol, pH7.3 | |
| 116211 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title