missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. TM4SF19 Rabbit anti-Human, Mouse, Polyclonal, Novus Biologicals™

TM4SF19 Rabbit anti-Human, Mouse, Polyclonal, Novus Biologicals™

Product Code. 18393797 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
20 μg
Unit Size:
100µL
20µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18393797 20 μg 20µL
18301337 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18393797 Supplier Novus Biologicals Supplier No. NBP31602620UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

TM4SF19 Polyclonal antibody specifically detects TM4SF19 in Human, Mouse samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen TM4SF19
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:2000
Formulation PBS, 50% glycerol, pH7.3
Gene Alias Osteoclast maturation-associated gene 4 protein, Tetraspan membrane protein OCTM4, transmembrane 4 L six family member 19, transmembrane 4 L6 family member 19
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human TM4SF19 (NP_001191827.1). LLGRHAMLGTGLWGGGLMVLTALLSGGLALLGALICFVTSGVALKDGPFCMFDVSSFNQTQAWKYGYPFKDLHSRNYLYDRSLWNSVCLEPSAAVVWHVSL
Purification Method Affinity purified
Quantity 20 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 116211
Target Species Human, Mouse
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.