missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TM4SF19 Rabbit anti-Human, Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-16026-20UL
This item is not returnable.
View return policy
Description
TM4SF19 Polyclonal antibody specifically detects TM4SF19 in Human, Mouse samples. It is validated for Western Blot
Specifications
| TM4SF19 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000 | |
| Osteoclast maturation-associated gene 4 protein, Tetraspan membrane protein OCTM4, transmembrane 4 L six family member 19, transmembrane 4 L6 family member 19 | |
| A synthetic peptide corresponding to a sequence within amino acids 50-150 of human TM4SF19 (NP_001191827.1). LLGRHAMLGTGLWGGGLMVLTALLSGGLALLGALICFVTSGVALKDGPFCMFDVSSFNQTQAWKYGYPFKDLHSRNYLYDRSLWNSVCLEPSAAVVWHVSL | |
| 20 μg | |
| Primary | |
| Human, Mouse | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS, 50% glycerol, pH7.3 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 116211 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction