missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TINAGL1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | TINAGL1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
TINAGL1 Polyclonal specifically detects TINAGL1 in Human samples. It is validated for Western Blot.Specifications
| TINAGL1 | |
| Polyclonal | |
| Rabbit | |
| Q9GZM7 | |
| 64129 | |
| Synthetic peptides corresponding to TINAGL1 (tubulointerstitial nephritis antigen-like 1) The peptide sequence was selected from the middle region of TINAGL1)(50ug). Peptide sequence NLIHEPLDQGNCAGSWAFSTAAVASDRVSIHSLGHMTPVLSPQNLLSCDT. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| androgen-regulated gene 1, ARG1, GIS5, Glucocorticoid-inducible protein 5, LCN7, LIECG3, lipocalin 7, OLRG2, OLRG-2, Oxidized LDL-responsive gene 2 protein, oxidized-LDL responsive gene 2, P3ECSL, TIN Ag-related protein, TINAGL, TINAG-like 1, TIN-Ag-RP, TINAGRP, tubulointerstitial nephritis antigen-like, tubulointerstitial nephritis antigen-like 1, Tubulointerstitial nephritis antigen-related protein | |
| TINAGL1 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title