TINAGL1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-57765

Product Code. 18273413

Description

TINAGL1 Polyclonal specifically detects TINAGL1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: TINAGL1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: androgen-regulated gene 1, ARG1, GIS5, Glucocorticoid-inducible protein 5, LCN7, LIECG3, lipocalin 7, OLRG2, OLRG-2, Oxidized LDL-responsive gene 2 protein, oxidized-LDL responsive gene 2, P3ECSL, TIN Ag-related protein, TINAGL, TINAG-like 1, TIN-Ag-RP, TINAGRP, tubulointerstitial nephritis antigen-like, tubulointerstitial nephritis antigen-like 1, Tubulointerstitial nephritis antigen-related protein
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Guinea Pig (Negative).
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9GZM7
• Gene Symbols: TINAGL1
• Immunogen: Synthetic peptides corresponding to TINAGL1 (tubulointerstitial nephritis antigen-like 1) The peptide sequence was selected from the middle region of TINAGL1)(50ug). Peptide sequence NLIHEPLDQGNCAGSWAFSTAAVASDRVSIHSLGHMTPVLSPQNLLSCDT.
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 64129
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.