missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Tight Junction Protein 2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£292.00 - £489.00
Specifications
| Antigen | Tight Junction Protein 2 |
|---|---|
| Dilution | Western Blot 0.04-0.4 μg/mL, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL |
| Applications | Western Blot, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18662567
|
Novus Biologicals
NBP2-68905-25ul |
25 μL |
£292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18673588
|
Novus Biologicals
NBP2-68905 |
100 μg |
£489.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Tight Junction Protein 2 Polyclonal antibody specifically detects Tight Junction Protein 2 in Human samples. It is validated for Western Blot, Immunocytochemistry/ ImmunofluorescenceSpecifications
| Tight Junction Protein 2 | |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Human | |
| C9DUPq21.11, DFNA51, DUP9q21.11, MGC26306, Tight junction protein 2, tight junction protein 2 (zona occludens 2), TJP2, X104, X104tight junction protein ZO-2, ZO2, ZO-2, ZO2Friedreich ataxia region gene X104 (tight junction protein ZO-2), Zona occludens protein 2, Zonula occludens protein 2 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: QHEESIRKPSPEPRAQMRRAASSDQLRDNSPPPAFKPEPPKAKTQNKEESYDFSKSYEYKSNPSAVAGNETPGASTKGYPPPVAAKPT | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.04-0.4 μg/mL, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol | |
| 9414 | |
| IgG | |
| Protein A purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title