Tight Junction Protein 2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-68905

Product Code. 18673588

Description

Tight Junction Protein 2 Polyclonal antibody specifically detects Tight Junction Protein 2 in Human samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence

Specifications

• Antigen: Tight Junction Protein 2
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 μg/mL, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL
• Gene Alias: C9DUPq21.11, DFNA51, DUP9q21.11, MGC26306, Tight junction protein 2, tight junction protein 2 (zona occludens 2), TJP2, X104, X104tight junction protein ZO-2, ZO2, ZO-2, ZO2Friedreich ataxia region gene X104 (tight junction protein ZO-2), Zona occludens protein 2, Zonula occludens protein 2
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: QHEESIRKPSPEPRAQMRRAASSDQLRDNSPPPAFKPEPPKAKTQNKEESYDFSKSYEYKSNPSAVAGNETPGASTKGYPPPVAAKPT
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9414
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG