missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Thymosin beta 4 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£149.00 - £366.00
Specifications
| Antigen | Thymosin beta 4 |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktkod | Brand | Quantity | Pris | Kvantitet och tillgänglighet | |||||
|
18610292
|
Novus Biologicals
NBP2-94152-0.02ml |
0.02 mL |
£149.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18643592
|
Novus Biologicals
NBP2-94152-0.1ml |
0.1 mL |
£366.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Beskrivning
Thymosin beta 4 Polyclonal antibody specifically detects Thymosin beta 4 in Human, Mouse, Rat samples. It is validated for Western BlotSpecifikationer
| Thymosin beta 4 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Biologically Active Proteins | |
| PBS (pH 7.3), 50% glycerol | |
| 7114 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| PTMB4, T beta-4, TB4, TB4Xbeta 4, X chromosome, THYB4, thymosin beta 4, X-linked, thymosin beta-4 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-44 of human TMSB4X (NP_066932.1). MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel