missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Thymosin beta 4 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94152-0.1ml
This item is not returnable.
View return policy
Description
Thymosin beta 4 Polyclonal antibody specifically detects Thymosin beta 4 in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
| Thymosin beta 4 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000 | |
| PTMB4, T beta-4, TB4, TB4Xbeta 4, X chromosome, THYB4, thymosin beta 4, X-linked, thymosin beta-4 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-44 of human TMSB4X (NP_066932.1). MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES | |
| 0.1 mL | |
| Biologically Active Proteins | |
| 7114 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction