missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Thymidine Kinase 2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£400.00
Specifications
| Antigen | Thymidine Kinase 2 |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
Description
Thymidine Kinase 2 Polyclonal specifically detects Thymidine Kinase 2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Thymidine Kinase 2 | |
| Unconjugated | |
| RUO | |
| EC 2.7.1.21, MTDPS2, Mt-TK, MTTK, thymidine kinase 2, mitochondrial | |
| TK2 | |
| IgG | |
| 34 kDa |
| Polyclonal | |
| Rabbit | |
| NP_004605 | |
| 7084 | |
| The specific Immunogen is proprietary information. Peptide sequence HLHEEWLIKGSLFPMAAPVLVIEADHHMERMLELFEQNRDRILTPENRKH. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title