Thymidine Kinase 2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-79890

Product Code. 18284397

Description

Thymidine Kinase 2 Polyclonal specifically detects Thymidine Kinase 2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Thymidine Kinase 2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 2.7.1.21, MTDPS2, Mt-TK, MTTK, thymidine kinase 2, mitochondrial
• Host Species: Rabbit
• Molecular Weight of Antigen: 34 kDa
• Quantity: 100 μL
• Research Discipline: Proteases & Other Enzymes
• Gene ID (Entrez): 7084
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
• Gene Accession No.: NP_004605
• Gene Symbols: TK2
• Immunogen: The specific Immunogen is proprietary information. Peptide sequence HLHEEWLIKGSLFPMAAPVLVIEADHHMERMLELFEQNRDRILTPENRKH.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Pig: 86%; Rat: 86%; Horse: 86%; Mouse: 86%; Guinea pig: 86%; Bovine: 85%; Rabbit: 79%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG