missing translation for 'onlineSavingsMsg'
Learn More
Learn More
THOC3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | THOC3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
THOC3 Polyclonal specifically detects THOC3 in Human samples. It is validated for Western Blot.Specifications
| THOC3 | |
| Polyclonal | |
| Rabbit | |
| Core ESC Like Genes, Stem Cell Markers | |
| hTREX45, MGC5469, TEX1 homolog, TEX1THO complex subunit 3, THO complex 3, tho3 | |
| THOC3 | |
| IgG | |
| This product is specific to Subunit or Isoform: 3. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q96J01 | |
| 84321 | |
| Synthetic peptides corresponding to THOC3(THO complex 3) The peptide sequence was selected from the middle region of THOC3. Peptide sequence LWEVQCESPTFTVAWHPKRPLLAFACDDKDGKYDSSREAGTVKLFGLPND. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title