missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TEKT3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | TEKT3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
TEKT3 Polyclonal specifically detects TEKT3 in Rat samples. It is validated for Western Blot.Specifications
| TEKT3 | |
| Polyclonal | |
| Rabbit | |
| Q4V8G8 | |
| 64518 | |
| Synthetic peptides corresponding to the N terminal of Tekt3. Immunizing peptide sequence MLPFVSNRTTLFTRYTPDDWYRSTLVGFQESNCSRHNSERLRVDTSRLIQ. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ32828, tektin 3, tektin-3, testicular microtubules-related protein | |
| TEKT3 | |
| IgG | |
| 54 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title