missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TEKT3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-74181
This item is not returnable.
View return policy
Description
TEKT3 Polyclonal specifically detects TEKT3 in Rat samples. It is validated for Western Blot.
Specifications
| TEKT3 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| FLJ32828, tektin 3, tektin-3, testicular microtubules-related protein | |
| Rabbit | |
| 54 kDa | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Chicken: 85%; Rabbit: 86%. | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q4V8G8 | |
| TEKT3 | |
| Synthetic peptides corresponding to the N terminal of Tekt3. Immunizing peptide sequence MLPFVSNRTTLFTRYTPDDWYRSTLVGFQESNCSRHNSERLRVDTSRLIQ. | |
| Affinity purified | |
| RUO | |
| 64518 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction