missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TCTN3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | TCTN3 |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
Description
TCTN3 Polyclonal specifically detects TCTN3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| TCTN3 | |
| Unconjugated | |
| RUO | |
| C10orf61, chromosome 10 open reading frame 61, DKFZP564D116, TECT3DKFZp564D116, tectonic 3, tectonic family member 3, tectonic-3 | |
| TCTN3 | |
| IgG |
| Polyclonal | |
| Rabbit | |
| Q6NUS6 | |
| 26123 | |
| Synthetic peptides corresponding to TCTN3(tectonic family member 3) The peptide sequence was selected from the middle region of TCTN3. Peptide sequence LTYFPKWSVISLLRQPAGVGAGGLCAESNPAGFLESKSTTCTRFFKNLAS. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title