missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TCTN3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-59741
This item is not returnable.
View return policy
Description
TCTN3 Polyclonal specifically detects TCTN3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| TCTN3 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| C10orf61, chromosome 10 open reading frame 61, DKFZP564D116, TECT3DKFZp564D116, tectonic 3, tectonic family member 3, tectonic-3 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 26123 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin | |
| Q6NUS6 | |
| TCTN3 | |
| Synthetic peptides corresponding to TCTN3(tectonic family member 3) The peptide sequence was selected from the middle region of TCTN3. Peptide sequence LTYFPKWSVISLLRQPAGVGAGGLCAESNPAGFLESKSTTCTRFFKNLAS. | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Bovine: 100%; Chicken: 100%; Canine: 100%; Equine: 100%; Rabbit: 100%; Rat: 100%. | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction