missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TCTE1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | TCTE1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
TCTE1 Polyclonal specifically detects TCTE1 in Human samples. It is validated for Western Blot.Specifications
| TCTE1 | |
| Polyclonal | |
| Rabbit | |
| Q5JU00 | |
| 202500 | |
| Synthetic peptides corresponding to TCTE1(t-complex-associated-testis-expressed 1) The peptide sequence was selected from the middle region of TCTE1. Peptide sequence MNFEWNLFLFTYRDCLSLAAAIKACHTLKIFKLTRSKVDDDKARIIIRSL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| D6S46, FLJ50041, MGC33600, T-complex-associated testis-expressed protein 1, t-complex-associated-testis-expressed 1, tcte-1 | |
| TCTE1 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title