TCTE1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-56639

Product Code. 18285073

Description

TCTE1 Polyclonal specifically detects TCTE1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: TCTE1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: D6S46, FLJ50041, MGC33600, T-complex-associated testis-expressed protein 1, t-complex-associated-testis-expressed 1, tcte-1
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 202500
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q5JU00
• Gene Symbols: TCTE1
• Immunogen: Synthetic peptides corresponding to TCTE1(t-complex-associated-testis-expressed 1) The peptide sequence was selected from the middle region of TCTE1. Peptide sequence MNFEWNLFLFTYRDCLSLAAAIKACHTLKIFKLTRSKVDDDKARIIIRSL.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Mouse: 100%; Canine: 92%; Equine: 92%; Rat: 92%; Chicken: 78%; Guinea pig: 78%.
• Target Species: Human, Mouse, Rat, Pig, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG