missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TCP10L Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£378.00
Specifications
| Antigen | TCP10L |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
Description
TCP10L Polyclonal specifically detects TCP10L in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| TCP10L | |
| Polyclonal | |
| Purified | |
| RUO | |
| Q8TDR4 | |
| 140290 | |
| Synthetic peptides corresponding to TCP10L(t-complex 10 (mouse)-like) The peptide sequence was selected from the middle region of TCP10L. Peptide sequence ASPHAGQESHTLALEPAFGKISPLSADEETIPKYAGHKNQSATLLGQRSS. | |
| Primary |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Human | |
| C21orf77, FLJ10932, gene similar to TCP10, spliced ESTs AA465232, MGC34297, PRED77, T1886510t-complex 10 (a murine tcp homolog)-like, t-complex 10 (mouse)-like, T-complex 10A-2, T-complex protein 10A homolog 2, T-complex protein 10A-2, TCP10A-2, TCP10-like | |
| TCP10L | |
| IgG | |
| Protein A purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title