TCP10L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-52846

Product Code. 18263442

Description

TCP10L Polyclonal specifically detects TCP10L in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: TCP10L
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: C21orf77, FLJ10932, gene similar to TCP10, spliced ESTs AA465232, MGC34297, PRED77, T1886510t-complex 10 (a murine tcp homolog)-like, t-complex 10 (mouse)-like, T-complex 10A-2, T-complex protein 10A homolog 2, T-complex protein 10A-2, TCP10A-2, TCP10-like
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 140290
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: Q8TDR4
• Gene Symbols: TCP10L
• Immunogen: Synthetic peptides corresponding to TCP10L(t-complex 10 (mouse)-like) The peptide sequence was selected from the middle region of TCP10L. Peptide sequence ASPHAGQESHTLALEPAFGKISPLSADEETIPKYAGHKNQSATLLGQRSS.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 78%.
• Target Species: Human
• Form: Purified