TBX18 Antibody [Unconjugated], Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-43683-25ul

Code produit. 30279394

Description

TBX18 Polyclonal antibody specifically detects TBX18 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence

Spécification

• Antigen: TBX18
• Classification: Polyclonal
• Dilution: Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL
• Gene Alias: T-box 18, T-box protein 18, T-box transcription factor TBX18
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GCEDGFQQGASPLASPGGSPKGSPARSLARPGTPLPSPQAPRVDLQGAELWKRFHEIGTEMIITKAGRRMFPAMRVKISGLDPHQQ
• Quantity: 25 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Immunocytochemistry/Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9096
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG