missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TBL3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | TBL3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
TBL3 Polyclonal specifically detects TBL3 in Human samples. It is validated for Western Blot.Specifications
| TBL3 | |
| Polyclonal | |
| Rabbit | |
| Q12788 | |
| 10607 | |
| Synthetic peptides corresponding to TBL3(transducin (beta)-like 3) The peptide sequence was selected from the N terminal of TBL3. Peptide sequence MAETAAGVGRFKTNYAVERKIEPFYKGGKAQLDQTGQHLFCVCGTRVNIL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| SAZDWD repeat-containing protein SAZD, transducin (beta)-like 3, transducin beta-like protein 3, WD-repeat protein SAZD | |
| TBL3 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title