TBL3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-58934

Product Code. 18249264

Description

TBL3 Polyclonal specifically detects TBL3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: TBL3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: SAZDWD repeat-containing protein SAZD, transducin (beta)-like 3, transducin beta-like protein 3, WD-repeat protein SAZD
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10607
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q12788
• Gene Symbols: TBL3
• Immunogen: Synthetic peptides corresponding to TBL3(transducin (beta)-like 3) The peptide sequence was selected from the N terminal of TBL3. Peptide sequence MAETAAGVGRFKTNYAVERKIEPFYKGGKAQLDQTGQHLFCVCGTRVNIL.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Mouse: 100%; Rat: 100%; Bovine: 92%; Guinea pig: 92%; Equine: 92%; Zebrafish: 90%; Canine: 85%; Xenopus: 84%; Chicken: 76%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Zebrafish
• Isotype: IgG