missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TauT/SLC6A6 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93858-0.1ml
This item is not returnable.
View return policy
Description
TauT/SLC6A6 Polyclonal antibody specifically detects TauT/SLC6A6 in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
| TauT/SLC6A6 | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000 | |
| MGC10619, MGC131729, sodium- and chloride-dependent taurine transporter, solute carrier family 6 (neurotransmitter transporter, taurine), member 6, TAUTSolute carrier family 6 member 6 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 250-320 of human SLC6A6 (NP_001127839.2). LFQSFQKELPWAHCNHSWNTPHCMEDTMRKNKSVWITISSTNFTSPVIEFWERNVLSLSPGIDHPGSLKWD | |
| 0.1 mL | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 6533 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction