missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Tau Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£240.00 - £443.00
Specifications
| Antigen | Tau |
|---|---|
| Dilution | Immunohistochemistry 1:5000 - 1:10000, Immunohistochemistry-Paraffin 1:5000 - 1:10000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18654636
|
Novus Biologicals
NBP2-49603-25ul |
25 μL |
£240.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18676187
|
Novus Biologicals
NBP2-49603 |
0.1 mL |
£443.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Tau Polyclonal antibody specifically detects Tau in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| Tau | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Alzheimers Research, Apoptosis, Cell Biology, Cellular Markers, Chaperone Mediated Autophagy (CMA), Cytokine Research, MAP Kinase Signaling, Neurodegeneration, Neuroscience, Stem Cell Markers | |
| PBS (pH 7.2), 40% Glycerol | |
| 4137 | |
| IgG | |
| Immunogen affinity purified |
| Immunohistochemistry 1:5000 - 1:10000, Immunohistochemistry-Paraffin 1:5000 - 1:10000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| DDPAC, FLJ31424, FTDP-17, G protein beta1/gamma2 subunit-interacting factor 1, MGC138549, microtubule-associated protein tau, MSTDMAPTL, MTBT1Neurofibrillary tangle protein, MTBT2, PHF-tau, PPND, tau, TAUPaired helical filament-tau | |
| This antibody was developed against a recombinant protein corresponding to amino acids: PLEFTFHVEITPNVQKEQAHSEEHLGRAAFPGAPGEGPEARGPSLGEDTKEADLPEPSEKQPAAAPRGKPVSRVPQLKARMVS | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title