Tau Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-49603

Product Code. 18676187

Description

Tau Polyclonal antibody specifically detects Tau in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: Tau
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:5000 - 1:10000, Immunohistochemistry-Paraffin 1:5000 - 1:10000
• Gene Alias: DDPAC, FLJ31424, FTDP-17, G protein beta1/gamma2 subunit-interacting factor 1, MGC138549, microtubule-associated protein tau, MSTDMAPTL, MTBT1Neurofibrillary tangle protein, MTBT2, PHF-tau, PPND, tau, TAUPaired helical filament-tau
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: PLEFTFHVEITPNVQKEQAHSEEHLGRAAFPGAPGEGPEARGPSLGEDTKEADLPEPSEKQPAAAPRGKPVSRVPQLKARMVS
• Quantity: 0.1 mL
• Research Discipline: Alzheimers Research, Apoptosis, Cell Biology, Cellular Markers, Chaperone Mediated Autophagy (CMA), Cytokine Research, MAP Kinase Signaling, Neurodegeneration, Neuroscience, Stem Cell Markers
• Gene ID (Entrez): 4137
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified