missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TARP Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | TARP |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
TARP Polyclonal specifically detects TARP in Human samples. It is validated for Western Blot.Specifications
| TARP | |
| Polyclonal | |
| Rabbit | |
| Q0VGM3 | |
| 445347 | |
| Synthetic peptides corresponding to the N terminal of TARP. Immunizing peptide sequence YMKFSWLTVPEKSLDKEHRCIVRHENNKNGVDQEIIFPPIKTDVITMDPK. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| CD3G, TARP TCR gamma alternate reading frame protein, TCRG, TCRGC1, TCRGC2 | |
| TARP | |
| IgG | |
| 13 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title