TARP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-74080

Product Code. 18288181

Description

TARP Polyclonal specifically detects TARP in Human samples. It is validated for Western Blot.

Specifications

• Antigen: TARP
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CD3G, TARP TCR gamma alternate reading frame protein, TCRG, TCRGC1, TCRGC2
• Host Species: Rabbit
• Molecular Weight of Antigen: 13 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Horse: 86%; Mouse: 86%; Pig: 79%; Rat: 79%.
• Target Species: Human, Mouse, Rat, Pig, Equine
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q0VGM3
• Gene Symbols: TARP
• Immunogen: Synthetic peptides corresponding to the N terminal of TARP. Immunizing peptide sequence YMKFSWLTVPEKSLDKEHRCIVRHENNKNGVDQEIIFPPIKTDVITMDPK.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 445347
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.