missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Tapasin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | Tapasin |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
Description
Tapasin Polyclonal specifically detects Tapasin in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Tapasin | |
| Unconjugated | |
| RUO | |
| 6892 | |
| Synthetic peptides corresponding to TAPBP (TAP binding protein (tapasin)) The peptide sequence was selected from the N terminal of TAPBP. Peptide sequence GKGLAKRPGALLLRQGPGEPPPRPDLDPELYLSVHDPAGALQAAFRRYPR. | |
| Primary |
| Polyclonal | |
| Rabbit | |
| NGS17, NGS-17, TAP binding protein (tapasin), tapasin, TAPATAP-associated protein, TPN, TPSNTAP-binding protein | |
| TAPBP | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title