Tapasin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-59070

Product Code. 18242241

Description

Tapasin Polyclonal specifically detects Tapasin in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Tapasin
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: TAPBP
• Immunogen: Synthetic peptides corresponding to TAPBP (TAP binding protein (tapasin)) The peptide sequence was selected from the N terminal of TAPBP. Peptide sequence GKGLAKRPGALLLRQGPGEPPPRPDLDPELYLSVHDPAGALQAAFRRYPR.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Equine: 92%; Pig: 92%; Rabbit: 92%; Mouse: 78%; Rat: 78%; Sheep: 78%.
• Target Species: Human, Mouse, Rat, Pig, Canine, Equine, Rabbit, Sheep
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
• Gene Alias: NGS17, NGS-17, TAP binding protein (tapasin), tapasin, TAPATAP-associated protein, TPN, TPSNTAP-binding protein
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6892
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.