missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TAAR5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | TAAR5 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
TAAR5 Polyclonal specifically detects TAAR5 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence.Specifications
| TAAR5 | |
| Polyclonal | |
| Rabbit | |
| GPCR, Vision | |
| 9038 | |
| Synthetic peptides corresponding to TAAR5 (trace amine associated receptor 5) The peptide sequence was selected from the middle region of TAAR5. Peptide sequence GWLNFPLFFVPCLIMISLYVKIFVVATRQAQQITTLSKSLAGAAKHERKA. | |
| Primary |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| MGC138414, MGC138416, PNRRP11-295F4.5, Putative neurotransmitter receptor, taR-5, trace amine associated receptor 5, Trace amine receptor 5, trace amine-associated receptor 5 | |
| TAAR5 | |
| IgG | |
| 38 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title