missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. TAAR5 Antibody, Novus Biologicals™

TAAR5 Antibody, Novus Biologicals™

Product Code. 18269043 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18269043 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18269043 Supplier Novus Biologicals Supplier No. NBP169132

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

TAAR5 Polyclonal specifically detects TAAR5 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence.
TRUSTED_SUSTAINABILITY

Specifications

Antigen TAAR5
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:10-1:2000
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias MGC138414, MGC138416, PNRRP11-295F4.5, Putative neurotransmitter receptor, taR-5, trace amine associated receptor 5, Trace amine receptor 5, trace amine-associated receptor 5
Gene Symbols TAAR5
Host Species Rabbit
Immunogen Synthetic peptides corresponding to TAAR5 (trace amine associated receptor 5) The peptide sequence was selected from the middle region of TAAR5. Peptide sequence GWLNFPLFFVPCLIMISLYVKIFVVATRQAQQITTLSKSLAGAAKHERKA.
Molecular Weight of Antigen 38 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline GPCR, Vision
Primary or Secondary Primary
Gene ID (Entrez) 9038
Test Specificity Expected to cross react based on sequence identity: Horse: 85%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.