TAAR5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-69132

Product Code. 18269043

Description

TAAR5 Polyclonal specifically detects TAAR5 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence.

Specifications

• Antigen: TAAR5
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: TAAR5
• Immunogen: Synthetic peptides corresponding to TAAR5 (trace amine associated receptor 5) The peptide sequence was selected from the middle region of TAAR5. Peptide sequence GWLNFPLFFVPCLIMISLYVKIFVVATRQAQQITTLSKSLAGAAKHERKA.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected to cross react based on sequence identity: Horse: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:10-1:2000
• Gene Alias: MGC138414, MGC138416, PNRRP11-295F4.5, Putative neurotransmitter receptor, taR-5, trace amine associated receptor 5, Trace amine receptor 5, trace amine-associated receptor 5
• Host Species: Rabbit
• Molecular Weight of Antigen: 38 kDa
• Quantity: 100 μL
• Research Discipline: GPCR, Vision
• Gene ID (Entrez): 9038
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.