missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SYT16 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | SYT16 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
SYT16 Polyclonal specifically detects SYT16 in Human samples. It is validated for Western Blot.Specifications
| SYT16 | |
| Polyclonal | |
| Rabbit | |
| Q17RD7 | |
| 83851 | |
| Synthetic peptides corresponding to SYT16 (synaptotagmin XVI) The peptide sequence was selected from the N terminal of SYT16. Peptide sequence DKLDQDLDNIQIQETYFEDEEQDNDWSQEDANSLFLEVDHFSCCNSDLQD. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| chr14 synaptotagmin, CHR14SYT, STREP14, Synaptotagmin 14-like protein, synaptotagmin XIV-like, Synaptotagmin XIV-related protein, synaptotagmin XVI, synaptotagmin-16, SYT14L, SYT14R, yt14r | |
| SYT16 | |
| IgG | |
| 72 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title