SYT16 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-69188

Product Code. 18264191

Description

SYT16 Polyclonal specifically detects SYT16 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SYT16
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: chr14 synaptotagmin, CHR14SYT, STREP14, Synaptotagmin 14-like protein, synaptotagmin XIV-like, Synaptotagmin XIV-related protein, synaptotagmin XVI, synaptotagmin-16, SYT14L, SYT14R, yt14r
• Host Species: Rabbit
• Molecular Weight of Antigen: 72 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Dog: 86% pig 85 %.
• Target Species: Human, Rat, Canine, Equine, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q17RD7
• Gene Symbols: SYT16
• Immunogen: Synthetic peptides corresponding to SYT16 (synaptotagmin XVI) The peptide sequence was selected from the N terminal of SYT16. Peptide sequence DKLDQDLDNIQIQETYFEDEEQDNDWSQEDANSLFLEVDHFSCCNSDLQD.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 83851
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.