Syntrophin Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-17941-100UL

Product Code. 18342604

Description

Syntrophin Polyclonal antibody specifically detects Syntrophin in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: Syntrophin
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: 59 kDa dystrophin-associated protein A1 acidic component 1, dJ1187J4.5, LQT12, Pro-TGF-alpha cytoplasmic domain-interacting protein 1, SNT1alpha-1-syntrophin, syntrophin, alpha 1 (dystrophin-associated protein A1, 59kD, acidic component), syntrophin, alpha 1 (dystrophin-associated protein A1, 59kDa, acidic component), syntrophin-1, TACIP1acidic alpha 1 syntrophin
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GTRHGVDTHLFSVESPQELAAWTRQLVDGCHRAAEGVQEVSTACTWNGRPCSLSVHIDKGFTLWAAEPGAARAVLLRQPFEKLQMS
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6640
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG