missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Syntenin 1 Rabbit anti-Human, Mouse, Rat, Clone: 3J5O6, Novus Biologicals™
Rabbit Monoclonal Antibody
£167.00 - £405.00
Specifications
| Antigen | Syntenin 1 |
|---|---|
| Clone | 3J5O6 |
| Dilution | Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin |
| Applications | Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Monoclonal |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18371627
|
Novus Biologicals
NBP3-16603-20UL |
20 μg |
£167.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18349744
|
Novus Biologicals
NBP3-16603-100UL |
100 μg |
£405.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Syntenin 1 Monoclonal antibody specifically detects Syntenin 1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)Specifications
| Syntenin 1 | |
| Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| MDA9, MDA-9, melanoma differentiation associated protein-9, Melanoma differentiation-associated protein 9, Pro-TGF-alpha cytoplasmic domain-interacting protein 18, Scaffold protein Pbp1, ST1, SYCLTACIP18, syndecan binding protein (syntenin), Syndecan-binding protein 1, syntenin-1 | |
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Syntenin 1 (O00560). MSLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGND | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| 3J5O6 | |
| Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cell Biology, Cytokines and Growth Factors, Immunology, Neuroscience | |
| PBS, 0.05% BSA, 50% glycerol, pH7.3 | |
| 6386 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title