Syntenin 1 Rabbit anti-Human, Mouse, Rat, Clone: 3J5O6, Novus Biologicals™

Rabbit Monoclonal Antibody

Brand:  Novus Biologicals NBP3-16603-100UL

Product Code. 18349744

Description

Syntenin 1 Monoclonal antibody specifically detects Syntenin 1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

• Antigen: Syntenin 1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS, 0.05% BSA, 50% glycerol, pH7.3
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified

• Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Clone: 3J5O6
• Dilution: Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin
• Gene Alias: MDA9, MDA-9, melanoma differentiation associated protein-9, Melanoma differentiation-associated protein 9, Pro-TGF-alpha cytoplasmic domain-interacting protein 18, Scaffold protein Pbp1, ST1, SYCLTACIP18, syndecan binding protein (syntenin), Syndecan-binding protein 1, syntenin-1
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Syntenin 1 (O00560). MSLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGND
• Quantity: 100 μg
• Research Discipline: Cell Biology, Cytokines and Growth Factors, Immunology, Neuroscience
• Gene ID (Entrez): 6386
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG