missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SYF2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £513.00
Specifications
| Antigen | SYF2 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18205654
|
Novus Biologicals
NBP2-57655 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18635207
|
Novus Biologicals
NBP2-57655-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SYF2 Polyclonal specifically detects SYF2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| SYF2 | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication | |
| CBPIN, CCNDBP1 interactor, CCNDBP1-interactor, DKFZp564O2082, fSAP29, functional spliceosome-associated protein 29, GCIP-interacting protein p29, GCIPIP, NTC31, P29, pre-mRNA-splicing factor SYF2, SYF2 homolog, RNA splicing factor (S. cerevisiae) | |
| SYF2 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 25949 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KRDKYSRRRPYNDDADIDYINERNAKFNKKAERFYGKYTAEIKQNLERGTAV | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title