missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SYF2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-57655
This item is not returnable.
View return policy
Description
SYF2 Polyclonal specifically detects SYF2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
| SYF2 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
| CBPIN, CCNDBP1 interactor, CCNDBP1-interactor, DKFZp564O2082, fSAP29, functional spliceosome-associated protein 29, GCIP-interacting protein p29, GCIPIP, NTC31, P29, pre-mRNA-splicing factor SYF2, SYF2 homolog, RNA splicing factor (S. cerevisiae) | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| SYF2 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KRDKYSRRRPYNDDADIDYINERNAKFNKKAERFYGKYTAEIKQNLERGTAV | |
| 100 μL | |
| Cell Cycle and Replication | |
| 25949 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction