missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SYDE1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£383.00
Specifications
| Antigen | SYDE1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
SYDE1 Polyclonal specifically detects SYDE1 in Human samples. It is validated for Western Blot, Knockout Validated.Specifications
| SYDE1 | |
| Polyclonal | |
| Rabbit | |
| Q6ZW31 | |
| 85360 | |
| Synthetic peptides corresponding to SYDE1(synapse defective 1, Rho GTPase, homolog 1 (C. elegans)) The peptide sequence was selected from the C terminal of SYDE1. Peptide sequence PYLRPKRQPPLHLPLADPEVVTRPRGRGGPESPPSNRYAGDWSVCGRDFL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| EC 2.4.1.25, EC 2.6.1.9, FLJ13511, Protein syd-1 homolog 1, rho GTPase-activating protein SYDE1, synapse defective 1, Rho GTPase, homolog 1 (C. elegans), Synapse defective protein 1 homolog 1,7h3 | |
| SYDE1 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title