SYDE1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-57607

Product Code. 18246073

Description

SYDE1 Polyclonal specifically detects SYDE1 in Human samples. It is validated for Western Blot, Knockout Validated.

Specifications

• Antigen: SYDE1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 2.4.1.25, EC 2.6.1.9, FLJ13511, Protein syd-1 homolog 1, rho GTPase-activating protein SYDE1, synapse defective 1, Rho GTPase, homolog 1 (C. elegans), Synapse defective protein 1 homolog 1,7h3
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 85360
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Knockout Validated
• Gene Accession No.: Q6ZW31
• Gene Symbols: SYDE1
• Immunogen: Synthetic peptides corresponding to SYDE1(synapse defective 1, Rho GTPase, homolog 1 (C. elegans)) The peptide sequence was selected from the C terminal of SYDE1. Peptide sequence PYLRPKRQPPLHLPLADPEVVTRPRGRGGPESPPSNRYAGDWSVCGRDFL.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Pig: 92%; Canine: 84%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG