SUV420H2 Antibody - Azide and BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-94300-0.1ml

Product Code. 18690502

Description

SUV420H2 Polyclonal antibody specifically detects SUV420H2 in Human, Mouse samples. It is validated for Western Blot, Gene Knock-Out

Specifications

• Antigen: SUV420H2
• Classification: Polyclonal
• Dilution: Western Blot 1:500 - 1:1000, Knockout Validated
• Gene Alias: EC 2.1.1.43, FLJ98627, histone-lysine N-methyltransferase SUV420H2, KMT5Csuv4-20h2, Lysine N-methyltransferase 5C, MGC2705, Su(var)4-20 homolog 2, Suppressor of variegation 4-20 homolog 2, suppressor of variegation 4-20 homolog 2 (Drosophila), Suv4-20h2
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human KMT5C (NP_116090.2). FLPESGFTILPCTRYSMETNGAKIVSTRAWKKNEKLELLVGCIAELREADEGLLRAGENDFSIMYSTRKRSAQLWLGPAAFINHDCKPNCKFVPADGNAAC
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Target Species: Human, Mouse
• Form: Purified

• Applications: Western Blot, Gene Knock-Out
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 84787
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG