SUV420h1 Antibody - Azide and BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-94791-0.02ml

Product Code. 18604932

Description

SUV420h1 Polyclonal antibody specifically detects SUV420h1 in Human, Mouse, Rat samples. It is validated for Western Blot

Specifications

• Antigen: SUV420h1
• Classification: Polyclonal
• Dilution: Western Blot 1:200-1:2000
• Gene Alias: C630029K18Rik, CGI85, CGI-85, EC 2.1.1.43, histone-lysine N-methyltransferase SUV420H1, KMT5B, KMT5B Lysine N-methyltransferase 5B, MGC118906, MGC118909, MGC21161, MGC703, Su(var)4-20 homolog 1, Suppressor of variegation 4-20 homolog 1, suppressor of variegation 4-20 homolog 1 (Drosophila), suv4-20h1
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human SUV420H1 (NP_060105.3). MNTSAFPSRSSRHFSKSDSFSHNNPVRFRPIKGRQEELKEVIERFKKDEHLEKAFKCLTSGEWARHYFLNKNKMQEKLFKEHVFIYLRMFATDSGFEILPC
• Quantity: 0.02 mL
• Research Discipline: Cancer, Epigenetics, Transcription Factors and Regulators
• Gene ID (Entrez): 51111
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified