missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SUPT7L Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £486.00
Specifications
| Antigen | SUPT7L |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18008793
|
Novus Biologicals
NBP2-57671 |
100 μL |
£486.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18698857
|
Novus Biologicals
NBP2-57671-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SUPT7L Polyclonal specifically detects SUPT7L in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| SUPT7L | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 9913 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PTMLDIPSEPCSLTIHTIQLIQHNRRLRNLIATAQAQNQQQTEGVKTEESEPLPSCPGSPPLPDDLLPLDCKNPNAPFQIRHSD | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| adenocarcinoma antigen ART1, KIAA0764, MGC90306, SPT7L, STAF65, STAF65(gamma), STAF65G, STAF65gamma, STAGA complex 65 gamma subunit, STAGA complex 65 subunit gamma, suppressor of Ty 7 (S. cerevisiae)-like, SUPT7H | |
| SUPT7L | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title