SUPT7L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-57671-25ul

Product Code. 18698857

Description

SUPT7L Polyclonal specifically detects SUPT7L in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: SUPT7L
• Classification: Polyclonal
• Dilution: Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: adenocarcinoma antigen ART1, KIAA0764, MGC90306, SPT7L, STAF65, STAF65(gamma), STAF65G, STAF65gamma, STAGA complex 65 gamma subunit, STAGA complex 65 subunit gamma, suppressor of Ty 7 (S. cerevisiae)-like, SUPT7H
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9913
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: SUPT7L
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PTMLDIPSEPCSLTIHTIQLIQHNRRLRNLIATAQAQNQQQTEGVKTEESEPLPSCPGSPPLPDDLLPLDCKNPNAPFQIRHSD
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

For Research Use Only