missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SUMO-interacting Motif (SIM) Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-30700
This item is not returnable.
View return policy
Description
SUMO-interacting Motif (SIM) Polyclonal specifically detects SUMO-interacting Motif (SIM) in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
| SUMO-interacting Motif (SIM) | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml | |
| Q8NDZ2 | |
| SIMC1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: MKIQQLHPANAKTVEWDWKLLTYVMEEEGQTLPGRVLFLRYVVQTLEDDFQQTLRRQRQHLQQSIANMVLSCDKQPHNVRDVIKWLVKA | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| Chromosome 5 Open Reading Frame 25, Oocyte Maturation Associated 1, OOMA1, Platform Element For Inhibition Of Autolytic Degradation, PLEIAD, SIMC1, SUMO-Interacting Motif-Containing Protein 1, SUMO-Interacting Motifs Containing 1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 375484 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction