missing translation for 'onlineSavingsMsg'
Learn More
Learn More
STRA13 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£393.00
Specifications
| Antigen | STRA13 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
STRA13 Polyclonal specifically detects STRA13 in Human samples. It is validated for Western Blot.Specifications
| STRA13 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| BHLHE40, CENPX, CENP-X, DEC1, FAAP10, FANCM-interacting histone fold protein 2, Fanconi anemia-associated polypeptide of 10 kDa, HLHB2, MGC14480, MHF2centromere protein X, Retinoic acid-inducible gene D9 protein homolog, stimulated by retinoic acid 13, stimulated by retinoic acid 13 homolog (mouse), Stimulated by retinoic acid gene 13 protein homolog | |
| Synthetic peptides corresponding to STRA13(stimulated by retinoic acid 13 homolog (mouse)) The peptide sequence was selected from the middle region of STRA13. Peptide sequence MEGAGAGSGFRKELVSRLLHLHFKDDKTKEAAVRGVRQAQAEDALRVDVD. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| A8MT69-2 | |
| 201254 | |
| IgG | |
| 7 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title